Location: Home > Product Category > >

Product Category

  1. Ⅰ.Amino Acids,Protected Amino Acids &Peptide Synthesis
  2. Ⅱ.Nucleosides,Nucleotides & DNA,RNA Synthesis
  3. Ⅲ.Saccharides,Natural Extracts & Enzyme
  4. Ⅳ.Chiral Reagents,Chiral Building Blocks
  5. Ⅴ.Advanced Chemcial Building Blocks
  6. Ⅵ.Chemical Synthesis Reagents
  7. High Purity Reagent,Analysis Reagent & Biological Reagent
  8. Material Chemistry Reagents
  9. Functional Chemicals & Intermediates
  10. Lab Equipments
  11. Lab Instruments
Sort By ABC: A   B   C   D    E    F    G    H    I    J    K   L   M   N   O   P   Q   R   S   T   U   V   W   X   Y   Z   1   2   3   4   5   6   7   8   9  
Cat # Abbreviation Product Name CAS Description Order Method Price/Packge E-Order
306P08 SFLLRN-NH2 TRAP-6 amide 141923-40-2 ,LR,H-Ser-Phe-Leu-Leu-Arg-Asn-NH2 Contact Salesman $0.00/ Order
306P11 FLLRN-OH TRAP-6 (2-6) 141136-84-7 ,LR,H-Phe-Leu-Leu-Arg-Asn-OH Contact Salesman $0.00/ Order
306P12 SFLLRNP-OH TRAP-7 145229-76-1 ,LR,H-Ser-Phe-Leu-Leu-Arg-Asn-Pro-OH Contact Salesman $0.00/ Order
306P14 SFLLRNPNDKYEPF-OH TRAP-14 137339-65-2 ,LR,H-Ser-Phe-Leu-Leu-Arg-Asn-Pro-Asn-Asp-Lys-Tyr-Glu-Pro-Phe-OH Contact Salesman $0.00/ Order
306P15 SFLLRNPNDKYEPF-NH2 TRAP-14 amide 141923-36-6 ,LR,H-Ser-Phe-Leu-Leu-Arg-Asn-Pro-Asn-Asp-Lys-Tyr-Glu-Pro-Phe-NH2 Contact Salesman $0.00/ Order
307P07 RFYVVM-OH Thrombospondin-1 (1016-1021) (human, bovine, mouse) 149234-06-0 ,LR,H-Arg-Phe-Tyr-Val-Val-Met-OH Contact Salesman $0.00/ Order
307P08 RFYVVMWK-OH Thrombospondin-1 (1016-1023) (human, bovine, mouse) 149234-04-8 ,LR,H-Arg-Phe-Tyr-Val-Val-Met-Trp-Lys-OH Contact Salesman $0.00/ Order
308P01 RKDVY-OH Thymopentin 177966-81-3 ,LR,H-Arg-Lys-Asp-Val-Tyr-OH Contact Salesman $0.00/ Order
308P02 GEQRKDVYVELYL-OH Thymopoietin I/II (29-41) (bovine) N/A ,LR,H-Gly-Glu-Gln-Arg-Lys-Asp-Val-Tyr-Val-Glu-Leu-Tyr-Leu-OH Contact Salesman $0.00/ Order
308P04 RKDV-OH Thymopoietin II (32-35) 85466-18-8 ,LR,H-Arg-Lys-Asp-Val-OH Contact Salesman $0.00/ Order
308P05 RKDVY-OEt Thymopoietin II (32-36)-ethyl ester 283167-49-7 ,LR,H-Arg-Lys-Asp-Val-Tyr-OEt Contact Salesman $0.00/ Order
308P06 KDVY-OH Thymopoietin II (33-36) N/A ,LR,H-Lys-Asp-Val-Tyr-OH Contact Salesman $0.00/ Order
308P07 DVY-OH Thymopoietin II (34-36) 75958-14-4 ,LR,H-Asp-Val-Tyr-OH Contact Salesman $0.00/ Order
309P02 Ac-SDAAVDTSSEITTKDLKEKKEV VEEAEN-OH Thymosin α1 62304-98-7 ,LR,Ac-Ser-Asp-Ala-Ala-Val-Asp-Thr-Ser-Ser-Glu-Ile-Thr-Thr-Lys-Asp-Leu-Lys-Glu-Lys-Lys-Glu-Val-Val-Glu-Glu-Ala-Glu-Asn-OH Contact Salesman $0.00/ Order
309P03 SDAAVDTSSEITTKDLKEKKEVVEE AEN-OH Thymosin α1 (deacetylated) (human, bovine, mouse, rat) 74221-77-5 ,LR,H-Ser-Asp-Ala-Ala-Val-Asp-Thr-Ser-Ser-Glu-Ile-Thr-Thr-Lys-Asp-Leu-Lys-Glu-Lys-Lys-Glu-Val-Val-Glu-Glu-Ala-Glu-Asn-OH Contact Salesman $0.00/ Order
309P04 Ac-SDKPDMAEIEKFDKSKLKKTETQ EKNPLPSKETIEQEKQAGES-OH Thymosin β4 (human, bovine, horse, rat) 77591-33-4 ,LR,Ac-Ser-Asp-Lys-Pro-Asp-Met-Ala-Glu-Ile-Glu-Lys-Phe-Asp-Lys-Ser-Lys-Leu-Lys-Lys-Thr-Glu-Thr-Gln-Glu-Lys-Asn-Pro-Leu-Pro-Ser-Lys-Glu-Thr-Ile-Glu-Gln-Glu-Lys-Gln-Ala-Gly-Glu-Ser-OH Contact Salesman $0.00/ Order
309P05 KLKKTETQEKNPLPSKETIEQEK-OH Thymosin β4 (16-38) N/A ,LR,H-Lys-Leu-Lys-Lys-Thr-Glu-Thr-Gln-Glu-Lys-Asn-Pro-Leu-Pro-Ser-Lys-Glu-Thr-Ile-Glu-Gln-Glu-Lys-OH Contact Salesman $0.00/ Order
309P06 Ac-ADKPDMGEIASFDKAKLKKTETQ EKNTLPTKETIEQEKRSEIS-OH Thymosin β10 (human, rat) 88160-82-1 ,LR,Ac-Ala-Asp-Lys-Pro-Asp-Met-Gly-Glu-Ile-Ala-Ser-Phe-Asp-Lys-Ala-Lys-Leu-Lys-Lys-Thr-Glu-Thr-Gln-Glu-Lys-Asn-Thr-Leu-Pro-Thr-Lys-Glu-Thr-Ile-Glu-Gln-Glu-Lys-Arg-Ser-Glu-Ile-Ser-OH Contact Salesman $0.00/ Order
310P03 Pyr-HP-NH2 TRH 24305-27-9 ,LR,Pyr-His-Pro-NH2 Contact Salesman $0.00/ Order
310P04 Pyr-HP-OH TRH (free acid) 24769-58-2 ,LR,Pyr-His-Pro-OH Contact Salesman $0.00/ Order
310P09 Pyr-HP-AMC TRH-AMC 190836-86-3 ,LR,Pyr-His-Pro-AMC Contact Salesman $0.00/ Order
310P10 Pyr-HPG-OH TRH-Gly 85344-77-0 ,LR,Pyr-His-Pro-Gly-OH Contact Salesman $0.00/ Order
310P11 Pyr-HP-4MβNA TRH-4MβNA 201982-88-9 ,LR,Pyr-His-Pro-4MβNA Contact Salesman $0.00/ Order
310P12 Pyr-HP-βNA TRH-βNA 73644-58-3 ,LR,Pyr-His-Pro-βNA Contact Salesman $0.00/ Order
310P13 SFPWMESDVT-OH TRH-Potentiating Peptide 122018-91-1 ,LR,H-Ser-Phe-Pro-Trp-Met-Glu-Ser-Asp-Val-Thr-OH Contact Salesman $0.00/ Order
311P02 VVSHFNKCPDSHTQYCFH GTCRFLVQEEKPACVCHS GYVGVRCEHADLLA-OH TGF α (1-50) (rat) 89899-53-6 ,LR,H-Val-Val-Ser-His-Phe-Asn-Lys-Cys-Pro-Asp-Ser-His-Thr-Gln-Tyr-Cys-Phe-His-Gly-Thr-Cys-Arg-Phe-Leu-Val-Gln-Glu-Glu-Lys-Pro-Ala-Cys-Val-Cys-His-Ser-Gly-Tyr-Val-Gly-Val-Arg-Cys-Glu-His-Ala-Asp-Leu-Leu-Ala-OH Contact Salesman $0.00/ Order
313P03 TKPR-OH Tuftsin 9063-57-4 ,LR,H-Thr-Lys-Pro-Arg-OH Contact Salesman $0.00/ Order
314P04 DKPVAHVVANPQAEGQLQWL NRRANAL-OH TNF-α (10-36) (human) N/A ,LR,H-Asp-Lys-Pro-Val-Ala-His-Val-Val-Ala-Asn-Pro-Gln-Ala-Glu-Gly-Gln-Leu-Gln-Trp-Leu-Asn-Arg-Arg-Ala-Asn-Ala-Leu-OH Contact Salesman $0.00/ Order
314P05 RRANALLANGVELRD-OH TNF-α (31-45) (human) 144796-71-4 ,LR,H-Arg-Arg-Ala-Asn-Ala-Leu-Leu-Ala-Asn-Gly-Val-Glu-Leu-Arg-Asp-OH Contact Salesman $0.00/ Order
314P06 NQLVVPSEGLYLIYSQVLFK-OH TNF-α (46-65) (human) 144796-72-5 ,LR,H-Asn-Gln-Leu-Val-Val-Pro-Ser-Glu-Gly-Leu-Tyr-Leu-Ile-Tyr-Ser-Gln-Val-Leu-Phe-Lys-OH Contact Salesman $0.00/ Order
315P01 SEIWRDIDF-OH Tyrosinase (192-200) (human, mouse) 170294-35-6 ,LR,H-Ser-Glu-Ile-Trp-Arg-Asp-Ile-Asp-Phe-OH Contact Salesman $0.00/ Order
315P02 AFLPWHRLF-OH Tyrosinase (206-214) (human) 166188-11-0 ,LR,H-Ala-Phe-Leu-Pro-Trp-His-Arg-Leu-Phe-OH Contact Salesman $0.00/ Order
315P03 KCDICTDEY-OH Tyrosinase (243-251) (human) 197171-78-1 ,LR,H-Lys-Cys-Asp-Ile-Cys-Thr-Asp-Glu-Tyr-OH Contact Salesman $0.00/ Order
323P31 GGGCYFQNCPKG-NH2 Terlipressin 14636-12-5 ,LR,H-Gly-Gly-Gly-Cys-Tyr-Phe-Gln-Asn-Cys-Pro-Lys-Gly-NH2 Contact Salesman $0.00/ Order
332P2545 T Cell Activation Gene-3 (mouse) N/A ,LR,H-Lys-Ser-Met-Leu-Thr-Val-Ser-Asn-Ser-Cys-Cys-Leu-Asn-Thr-Leu-Lys-Lys-Glu-Leu-Pro-Leu-Lys-Phe-Ile-Gln-Cys-Tyr-Arg-Lys-Met-Gly-Ser-Ser-Cys-Pro-Asp-Pro-Pro-Ala-Val-Val-Phe-Arg-Leu-Asn- Contact Salesman $0.00/ Order
332P2547 Thymus and Activation-Regulated Chemokine (human) 439555-96-1 ,LR,H-Ala-Arg-Gly-Thr-Asn-Val-Gly-Arg-Glu-Cys-Cys-Leu-Glu-Tyr-Phe-Lys-Gly-Ala-Ile-Pro-Leu-Arg-Lys-Leu-Lys-Thr-Trp-Tyr-Gln-Thr-Ser-Glu-Asp-Cys-Ser-Arg-Asp-Ala-Ile-Val-Phe-Val-Thr-Val-Gln- Contact Salesman $0.00/ Order
4P01 APSGAQRLYGFGL-NH2 Type A Allatostatin I 123338-10-3 ,LR,H-Ala-Pro-Ser-Gly-Ala-Gln-Arg-Leu-Tyr-Gly-Phe-Gly-Leu-NH2 Order in Advanced $0.00/5mg $0.00/50mg Order
4P02 GDGRLYAFGL-NH2 Type A Allatostatin II 123338-11-4 ,LR,H-Gly-Asp-Gly-Arg-Leu-Tyr-Ala-Phe-Gly-Leu-NH2 Contact Salesman $0.00/ Order
4P03 GGSLYSFGL-NH2 Type A Allatostatin III 123338-12-5 ,LR,H-Gly-Gly-Ser-Leu-Tyr-Ser-Phe-Gly-Leu-NH2 Contact Salesman $0.00/ Order
4P04 DRLYSFGL-NH2 Type A Allatostatin IV 123338-13-6 ,LR,H-Asp-Arg-Leu-Tyr-Ser-Phe-Gly-Leu-NH2 Contact Salesman $0.00/ Order
4P05 AYSYVSEYKR
LPVYNFGL-NH2
Type B Allatostatin N/A ,LR,H-Ala-Tyr-Ser-Tyr-Val-Ser-Glu-Tyr-Lys-Arg-Leu-
Pro-Val-Tyr-Asn-Phe-Gly-Leu-NH2
Contact Salesman $0.00/ Order
7P05 TAPRSLRRSSCFGGRMDRIGAQSGLGCNSFRY-OH Thr-Ala-Pro-Arg-Atrial Natriuretic Factor (1-28) (human, bovine, porcine) 115966-23-9 ,LR,H-Thr-Ala-Pro-Arg-Ser-Leu-Arg-Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Met-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr-OH Contact Salesman $0.00/ Order
10P28 YRPPGFSPFR-OH Tyr-Bradykinin N/A ,LR,H-Tyr-Arg-Pro-Pro-Gly-Phe-Ser-Pro-Phe-Arg-OH Contact Salesman $0.00/ Order
11P06 YACDTATCVTHRLAGLLSRSGGVVKNN FVPTNVGSKAF-NH2 Tyr-α-CGRP (human) 124756-98-5 ,LR,H-Tyr-Ala-Cys-Asp-Thr-Ala-Thr-Cys-Val-Thr-His-Arg-Leu-Ala-Gly-Leu-Leu-Ser-Arg-Ser-Gly-Gly-Val-Val-Lys-Asn-Asn-Phe-Val-Pro-Thr-Asn-Val-Gly-Ser-Lys-Ala-Phe-NH2 Contact Salesman $0.00/ Order
11P14 YVKDNFVPTNVGSEAF-NH2 Tyr-α-CGRP (23-37) (mouse, rat) 198277-54-2 ,LR,H-Tyr-Val-Lys-Asp-Asn-Phe-Val-Pro-Thr-Asn-Val-Gly-Ser-Glu-Ala-Phe-NH2 Contact Salesman $0.00/ Order
42P17 YMEHFRW-OH Tyr-ACTH (4-9) 129813-57-6 ,LR,H-Tyr-Met-Glu-His-Phe-Arg-Trp-OH Order in Advanced $42.00/5 mg $140.00/25 mg Order
42P20 YMEHFRWG-OH Tyr-ACTH (4-10) 131374-17-9 ,LR,H-Tyr-Met-Glu-His-Phe-Arg-Trp-Gly-OH Order in Advanced $53.00/5 mg $175.00/25 mg Order
B17678 Thioacetic Acid S-Potassium Salt Thioacetic Acid S-Potassium Salt 10387-40-3 98% ,LR ,MERCAPTOACETIC ACID, POTASSIUM SALT;KTAA Contact Salesman $0.00/ Order
B15840 tert-Butyl acrylate tert-Butyl acrylate 1663-39-4 98% ,LR ,2-Propenoic acid, 1,1-dimethylethyl ester; Contact Salesman $0.00/ Order
B15841 Trifluoromethanesulfonic acid Trifluoromethanesulfonic acid 1493-13-6 98%,LR,Fluorad FC-24;Methanesulfonic acid, trifluoro-; Contact Salesman $0.00/ Order


Sales Department :Room 206-209, NO.1 Building , NO.245,Jiachuan Road, Xuhui District, Shanghai, China . E-Mail:info@hanhonggroup.com