Location: Home > Product Category > >

Product Category

  1. Ⅰ.Amino Acids,Protected Amino Acids &Peptide Synthesis
  2. Ⅱ.Nucleosides,Nucleotides & DNA,RNA Synthesis
  3. Ⅲ.Saccharides,Natural Extracts & Enzyme
  4. Ⅳ.Chiral Reagents,Chiral Building Blocks
  5. Ⅴ.Advanced Chemcial Building Blocks
  6. Ⅵ.Chemical Synthesis Reagents
  7. High Purity Reagent,Analysis Reagent & Biological Reagent
  8. Material Chemistry Reagents
  9. Functional Chemicals & Intermediates
  10. Lab Equipments
  11. Lab Instruments
Sort By ABC: A   B   C   D    E    F    G    H    I    J    K   L   M   N   O   P   Q   R   S   T   U   V   W   X   Y   Z   1   2   3   4   5   6   7   8   9  
Cat # Abbreviation Product Name CAS Description Order Method Price/Packge E-Order
B15731 Phenyl trifluoroacetate 500-73-2 96%,LR ,PHENYL TRIFLUOROACETATE; Contact Salesman $86.00/100g $200.00/500g Order
B351200 Phenyl acetate Phenyl acetate 122-79-2 ,LR, Contact Salesman $0.00/ Order
B69001 Pyridazine 289-80-5 95% ,LR , Contact Salesman $0.00/ Order
00116 Pht-Ala-OH Phthaloyl-L-Alanine 4192-28-3 >98.5%,LR, Contact Salesman $150.00/25g $250.00/100g Order
004150 Poly-L-aspartic acid Poly-L-aspartic acid 25608-40-6 ,LR, Contact Salesman $0.00/ Order
007181 Phthalyl-DL-glutamic Acid Phthalyl-DL-glutamic Acid 2301-52-2 ,LR, Contact Salesman $0.00/ Order
007193 pal-glu(osu)-otbu pal-glu(osu)-otbu N/A ,LR, Contact Salesman $0.00/ Order
007194 Pal-glu-otbu Pal-glu-otbu N/A ,LR, Contact Salesman $0.00/ Order
00738 Pht-Glu-OH Phthaloyl-L-glutamic acid 340-90-9 ,LR, Contact Salesman $100.00/25g $250.00/100g Order
00787 P-Nitrobenzoyl-L-Glutamic Acid 6758-40-3 ,LR, Contact Salesman $0.00/ Order
00828 PHENYLAC-GLN-OH PHENYLAC-GLN-OH 28047-15-6 ,LR, Contact Salesman $37.10/1g $149.90/5g Order
00908 Pht-Gly-OH Phthaloyl-glycine 4702-13-0 ,LR, Contact Salesman $150.00/100g $300.00/250g Order
00909 Pht-Gly-OtBu Phthaloyl-glycine tert·butyl ester 6297-93-4 ,LR, In Stock $250.00/5g $500.00/25g Order
00971 Phenylac-Gly-OH Phenylac-Gly-OH 500-98-1 ,LR,Tech, Contact Salesman $37.00/1g $123.00/5g Order
00989 PHT-GLY-OSU PHT-GLY-OSU 3397-29-3 ,LR, Contact Salesman $0.00/ Order
01220 Pht-lle-OH Phthaloyl-L-isoleucine 29588-88-3 ,LR, Contact Salesman $150.00/5g $300.00/25g Order
01313 Pht-Leu-OH Phthaloyl-L-Leucine 2419-38-7 ,LR, Contact Salesman $150.00/100g $300.00/250g Order
01565 Palmitoyl-Met-OH Palmitoyl-Met-OH 36416-81-6 ,LR,Tech, Order in Advanced $120.00/1g $250.00/5g Order
01618 Pht-Phe-OH Phthaloyl-L-Phenylalanine 5123-55-7 98%,LR , Contact Salesman $65.00/25g $195.00/100g Order
01695 Phenylac-Phe-OH Phenylac-Phe-OH 738-75-0 ,LR,Tech, Contact Salesman $102.00/5g $396.00/25g Order
01748 Pz-Pro-OH Pz-Pro-OH N/A 98%,LR,Tech, Contact Salesman $150.00/5g $300.00/25g Order
01749 Pz-Pro-OSu Pz-Pro-OSu N/A ,LR,Tech, Contact Salesman $300.00/5g $600.00/25g Order
02216 Pht-Val-OH Phthaloyl-L-Valine 6306-54-3 98%,LR, In Stock $70.00/25g $150.00/100g Order
02286 POLY-L-VALINE POLY-L-VALINE 25609-85-2 ,LR, Contact Salesman $0.00/ Order
08542 Pht-R-Nle-OH Pht-R-Nle-OH 1221409-47-7 ,LR, In Stock $250.00/5g $750.00/25g Order
09012 Phenylsulfonyl-Sar-OH Phenylsulfonyl-Sar-OH 46376-16-3 ,LR,Tech, Contact Salesman $122.90/1g $492.10/5g Order
09754 Phenylglycine methyl ester hydrochloride Phenylglycine methyl ester hydrochloride 15028-40-7 ,LR, Contact Salesman $0.00/ Order
110P01 Pyr-W-OH Pyr-Trp-OH N/A ,LR,Pyr-Trp-OH Contact Salesman $0.00/ Order
111P02 Pyr-W-OEt Pyr-Trp-OEt N/A ,LR,Pyr-Trp-OEt Contact Salesman $0.00/ Order
133P18 Pyr-DPFLRF-NH2 Pyr-Asp-Pro-Phe-Leu-Arg-Phe-NH2 98495-35-3 ,LR,Pyr-Asp-Pro-Phe-Leu-Arg-Phe-NH2 Contact Salesman $0.00/ $0.00/ Order
138P13 Boc-β-AWMDF-NH2 Pentagastrin 5534-95-2 ,LR,Boc-β-Ala-Trp-Met-Asp-Phe-NH2 Contact Salesman $0.00/ $0.00/ Order
13RA10490033 Potassium iodide Potassium iodide 7681-11-0 99,ACS, Contact Salesman $0.00/ Order
16201 Pentafluoro-L-Phe-OH Pentafluoro-L-Phenylalanine 34702-59-5 ,LR, In Stock $3750.00/100g $8750.00/500g Order
16202 Pentafluoro-D-Phe-OH Pentafluoro-D-Phenylalanine 40332-58-9 ,LR, In Stock $3750.00/100g $8750.00/500g Order
16203 Pentafluoro-DL-Phe-OH Pentafluoro-DL-Phenylalanine N/A ,LR, In Stock $2500.00/100g $5000.00/500g Order
163P01 MGTNLSVPNPLGFFPDHQLDP-OH Pre-S1 (12-32) N/A ,LR,H-Met-Gly-Thr-Asn-Leu-Ser-Val-Pro-Asn-Pro-Leu-Gly-Phe-Phe-Pro-Asp-His-Gln-Leu-Asp-Pro-OH Contact Salesman $0.00/ $0.00/ Order
163P02 MQWNSTAFHQTLQDPRVRGLYLPAGG-OH Pre-S2 (1-26) N/A ,LR,H-Met-Gln-Trp-Asn-Ser-Thr-Ala-Phe-His-Gln-Thr-Leu-Gln-Asp-Pro-Arg-Val-Arg-Gly-Leu-Tyr-Leu-Pro-Ala-Gly-Gly-OH Contact Salesman $0.00/ $0.00/ Order
167P10 p-Hydroxyhippuryl-HL-OH p-Hydroxyhippuryl-His-Leu-OH 77697-23-5 ,LR,p-Hydroxyhippuryl-His-Leu-OH Contact Salesman $0.00/250mg Order
1RA10490050 Potassium phosphate dibasic anhydrous Potassium phosphate dibasic anhydrous 7758-11-4 99.99,LR, Contact Salesman $0.00/ Order
207P05 VDWKKIGQHILSVL-NH2 Polistes Mastoparan 74129-19-4 ,LR,H-Val-Asp-Trp-Lys-Lys-Ile-Gly-Gln-His-Ile-Leu-Ser-Val-Leu-NH2 Contact Salesman $0.00/ Order
22701 Piperidine-4-carboxylic acid Piperidine-4-carboxylic acid 498-94-2 ,LR, In Stock $100.00/100g $200.00/500g Order
229P22 APLEPVYPGDNATPEQMARYY SALRHYINLA-Aib-RQRY-NH2 Pancreatic Polypeptide (1-17)-(Ala31,Aib32)-Neuropeptide Y (18-36) (human) 313988-70-4 ,LR,H-Ala-Pro-Leu-Glu-Pro-Val-Tyr-Pro-Gly-Asp-Asn-Ala-Thr-Pro-Glu-Gln-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ala-Aib-Arg-Gln-Arg-Tyr-NH2 Contact Salesman $0.00/ Order
22P02 SVSEIQLMHNLGKHLNSMERVEWLRKKLQDV-OH pTH (1-31) (human) 157938-23-3 ,LR,H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-OH Contact Salesman $0.00/ Order
22P03 SVSEIQLMHNLGKHLNSMERVEWLRKKLQDV-NH2 pTH (1-31) amide (human) 173833-08-4 ,LR,H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-NH2 Contact Salesman $0.00/ Order
22P05 AVSEIQFMHNLGKHLSSMERVEWLRKKLQDVHNF-OH pTH (1-34) (bovine) 12583-68-5 ,LR,H-Ala-Val-Ser-Glu-Ile-Gln-Phe-Met-His-Asn-Leu-Gly-Lys-His-Leu-Ser-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OH Contact Salesman $0.00/ Order
22P07 SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF-OH pTH (1-34) (human) 52232-67-4 ,LR,H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OH Contact Salesman $0.00/ Order
22P08 SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF-NH2 pTH (1-34) amide (human) 83139-29-1 ,LR,H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-NH2 Contact Salesman $0.00/ Order
22P12 SVSEIQLMHNLGKHLSSLERVEWLRKKLQDVHNF-OH pTH (1-34) (porcine) N/A ,LR,H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Ser-Ser-Leu-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OH Contact Salesman $0.00/ Order
22P13 AVSEIQLMHNLGKHLASVERMQWLRKKLQDVHNF-OH pTH (1-34) (rat) 98614-76-7 ,LR,H-Ala-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Ala-Ser-Val-Glu-Arg-Met-Gln-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OH Contact Salesman $0.00/ Order
22P15 SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVAL-OH pTH (1-37) (human) 136799-54-7 ,LR,H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-Val-Ala-Leu-OH Contact Salesman $0.00/ Order


Sales Department :Room 206-209, NO.1 Building , NO.245,Jiachuan Road, Xuhui District, Shanghai, China . E-Mail:info@hanhonggroup.com